missing translation for 'onlineSavingsMsg'
Learn More

SPRR3 Recombinant Protein, Abnova

Marca:  Abnova H00006707-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16160962

  • 458.00€ / 25µg


Spedizione stimata
25-11-2020
Aggiungi al carrello

Descrizione

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH17802
Solution
6707
SPRR3 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SPRR3
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
43.45
8
Glutathione Sepharose 4 Fast Flow
25 ug
MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK
SPRR3
Human
Yes
Videos
Documenti