missing translation for 'onlineSavingsMsg'
Learn More

STK4 Recombinant Protein, Abnova

Marca:  Abnova H00006789-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16161092

  • 458.00€ / 25µg


Spedizione stimata
30-11-2020
Aggiungi al carrello

Descrizione

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH05231
Solution
6789
STK4 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
STK4
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
30.03
8
Glutathione Sepharose 4 Fast Flow
25 ug
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG
DKFZp686A2068|KRS2|MST1|YSK3
STK4
Wheat Germ (in vitro)
GST
Videos
SDS
Documenti