missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. R&D Systems™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

R&D Systems™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Codice prodotto. p-200087451 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
1 mg
5 mg
Dimensione della confezione:
1mg
5mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18708203 1 mg 1mg
18467731 5 mg 5mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18708203 Fornitore R&D Systems™ N. del fornitore NBP226245
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Applications: Flow Cytometry, In vitro assay

TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da

TRUSTED_SUSTAINABILITY

Specifica

Product Line Novus
Colore White
Content And Storage TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
Da utilizzare con (applicazione) Inhibit TLR2 and TLR4 signaling
Product Type TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Quantità 1 mg

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.