missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Produktkode 18708203 Shop alle Bio Techne produkter
missing translation for 'orderingAttributeHoverText'
Quantità:
5 mg
Förpackningsstorlek
5mg
Denne vare kan ikke returneres. Se returpolitik

Produktkode 18708203

missing translation for 'mfr': Novus Biologicals™ NBP226245

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Applications: Flow Cytometry, In vitro assay

TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da

TRUSTED_SUSTAINABILITY

For Research Use Only

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.