missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Codice prodotto. 18708203 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
5 mg
Dimensione della confezione:
5mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18708203 - -
18467731 5 mg 5mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”27950” to get your promotional price
Codice prodotto. 18708203 Fornitore Novus Biologicals™ N. del fornitore NBP226245
  • ONLINE EXCLUSIVE PRICE
    846.00€
    800.10€ / 1mg
    Risparmia 45.90€
    5% Sconto
Visualizza tutte le promozioni
 Articolo soggetto a restrizioni
Spedizione stimata: 28-09-2026
Aggiungi al carrello
564.00 EUR valido fino al 2026-09-30
MIGLIOR PREZZO in promozione! Usa il codice promo "27950" per avere il tuo prezzo promozionale.
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”27950” to get your promotional price

Descrizione

Applications: Flow Cytometry, In vitro assay

TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da

TRUSTED_SUSTAINABILITY

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.