missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18302549

TRMU Antibody, Novus Biologicals™

Codice prodotto. 18302549 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
50 μg
Dimensione della confezione:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18302549 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18302549 Fornitore Novus Biologicals N. del fornitore H00055687B01P50ug

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Mouse Polyclonal Antibody

TRMU Polyclonal antibody specifically detects TRMU in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifica

Antigene TRMU
Applicazioni Western Blot
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot
Formulazione PBS (pH 7.4)
N. accesso geni AAH80631.1
Alias gene EC 2.8.1, EC 2.8.1.-, FLJ10140, mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase, mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog, MTO2MGC99627, MTU1, TRMT, TRMT1, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase, TRNT1
Specie ospite Mouse
Immunogeno TRMU (AAH80631.1, 1 a.a. - 222 a.a.) full-length human protein. MKKSLSRSTLRSPNGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVCCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH
Metodo di purificazione Immunogen affinity purified
Quantità 50 μg
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 55687
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Forma Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.