Risultati della ricerca filtrata
I prodotti di alcuni dei nostri fornitori non vengono visualizzati nei risultati della ricerca filtrata. Si prega di
deselezionare tutti i filtri
per vedere questi prodotti.
1
–
15
di
948,376
risultati
| Alias gene | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
|---|---|
| Simboli geni | TP53BP1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Specie ospite | Mouse |
|---|---|
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunogeno | Recombinant Listeria monocytogenes p60. |
| Target Species | Bacteria |
| Applicazioni | Western Blot,ELISA |
| Coniugato | Unconjugated |
| Classificazione | Monoclonal |
| Alias gene | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Isotype | IgG1 κ |
| Test di specificità | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Forma | Purified |
| Antigene | Listeria monocytogenes p60 |
| Metodo di purificazione | Protein G purified |
| Status giuridico | RUO |
| Formulazione | 0.2um-filtered solution in PBS, pH 7.4. |
| Diluizione | Western Blot, ELISA |
| Concentrazione | 1 mg/mL |
| Primario o secondario | Primary |
| Clone | p6007 |
Rabbit IgG Isotype Control, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 36 publications
Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
| ID gene (immissione) | 3014 |
|---|---|
| Specie ospite | Mouse |
| Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
| Immunogeno | This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139. |
| N. accesso geni | P16104 |
| Target Species | Human |
| Applicazioni | Western Blot |
| Coniugato | Unconjugated |
| Peso molecolare dell'antigene | 15 kDa |
| Classificazione | Monoclonal |
| Alias gene | H2A.X, H2A/X, H2AFX |
| Isotype | IgG1 κ |
| Test di specificità | In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section. |
| Forma | Purified |
| Antigene | Histone H2AX (p Ser139) |
| Metodo di purificazione | Protein G purified |
| Simboli geni | H2AFX |
| Status giuridico | RUO |
| Disciplina di ricerca | Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific |
| Diluizione | Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500 |
| Concentrazione | 1 mg/mL |
| Primario o secondario | Primary |
| Clone | 3F2 |
| Peso molecolare | 33.4 kDa |
|---|---|
| ID gene (immissione) | 3919448 |
| Proteine | Protein A |
| Purity or Quality Grade | >97% pure by SDS-PAGE and HPLC |
| Ricostituzione | Dissolve in distilled water or saline. |
| Concentrazione di endotossine | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Alias gene | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Da utilizzare con (applicazione) | PAGE,Bioactivity,HPLC |
| Research Category | Epitope Tags |
| Formulazione | Lyophilized from additive free solution. |
| Requisiti di stoccaggio | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentrazione | LYOPH |
| ID gene (immissione) | 11081 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogeno | This antibody was developed against Recombinant Protein corresponding to amino acids:SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL |
| Target Species | Human,Mouse |
| Applicazioni | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | CNA2, keratocan, KTN, SLRR2BKeratan sulfate proteoglycan keratocan |
| Isotype | IgG |
| Test di specificità | Specificity of human KERA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Antigene | KERA |
| Metodo di purificazione | Affinity Purified |
| Simboli geni | KERA |
| Status giuridico | RUO |
| Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Diluizione | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Primario o secondario | Primary |
| ID gene (immissione) | 143872 |
|---|---|
| Specie ospite | Mouse |
| Immunogeno | Purified recombinant fragment of human ARHGAP42 (AA: 577-719) expressed in E. Coli. |
| Applicazioni | Western Blot,ELISA |
| Coniugato | Unconjugated |
| Peso molecolare dell'antigene | 98.6 kDa |
| Classificazione | Monoclonal |
| Alias gene | FLJ32810, Rho GTPase activating protein 42 |
| Isotype | IgG1 |
| Forma | Purified |
| Antigene | ARHGAP42 |
| Metodo di purificazione | Protein G purified |
| Simboli geni | ARHGAP42 |
| Diluizione | Western Blot 1:100-1:2000, ELISA 1:100-1:2000 |
| Concentrazione | 1 mg/mL |
| Primario o secondario | Primary |
| Clone | 2F1A7 |