missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Acetyl-coenzyme A transporter 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
498.00€ - 750.00€
Specifica
| Antigene | Acetyl-coenzyme A transporter 1 |
|---|---|
| Diluizione | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applicazioni | Immunofluorescence |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18625667
|
Novus Biologicals
NBP2-68761-25ul |
25 μL |
498.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18676296
|
Novus Biologicals
NBP2-68761 |
100 μg |
750.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
Acetyl-coenzyme A transporter 1 Polyclonal antibody specifically detects Acetyl-coenzyme A transporter 1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifica
| Acetyl-coenzyme A transporter 1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ACATNAcetyl-CoA transporter 1, acetyl-Coenzyme A transporter, AT-1acetyl-coenzyme A transporter 1, AT1SPG42, solute carrier family 33 (acetyl-CoA transporter), member 1, Solute carrier family 33 member 1, spastic paraplegia 42 (autosomal dominant) | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 9197 | |
| IgG | |
| Protein A purified |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto