missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AP1S1 (Human) Recombinant Protein

Human AP1S1 full-length ORF ( AAH03561, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00001174-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16173261

  • 508.00€ / 25µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

  • Sequence: MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH
Specifica

Specifica

AAH03561
adaptor-related protein complex 1, sigma 1 subunit
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AP1S1
GST
1174
Wheat germ expression system
25 μg
AP19, CLAPS1, FLJ92436, SIGMA1A, WUGSC:H_DJ0747G18.2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali