missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APPBP2 Antibody, R&D Systems™

APPBP2 Antibody, R&D Systems™

Código de producto. 18601974 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Quantity:
100 μg
25 μg
Tamaño de la unidad:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity Tamaño de la unidad
18601974 25 μg 25µL
18684504 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18601974 Proveedor Novus Biologicals N.º de proveedor NBP32131025ul
  • ONLINE EXCLUSIVE PRICE
    594.52€
    510.30€ / 25µL
    Risparmia 84.22€
    14% Sconto
 Restricted Item
Spedizione stimata: 01-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

APPBP2 Polyclonal specifically detects APPBP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen APPBP2
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias amyloid beta precursor protein (cytoplasmic tail) binding protein 2, Amyloid beta precursor protein-binding protein 2, amyloid protein-binding protein 2, APP-BP2, KIAA0228HS.84084, PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2, Protein interacting with APP tail 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 10513
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.