missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin 1/AQP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marca: Novus Biologicals NBP1-84488-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Aquaporin 1/AQP1 Polyclonal specifically detects Aquaporin 1/AQP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifica
| Aquaporin 1/AQP1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
| 28-kDa, AQP-1, AQP-CHIP, aquaporin 1 (channel-forming integral protein, 28kDa), aquaporin 1 (Colton blood group), Aquaporin-CHIP, CHIP2828kDa, CO blood group), CO, MGC26324 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 358 | |
| Human, Mouse | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AQP1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto