missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ASGR1 Recombinant Protein
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
Descrizione
- Encoded by ASGR1 gene with asialoglycoprotein receptor 1
- Preparation method:in vitro wheat germ expression system
- Molecular weight: 57.75kDa
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in the elution buffer
Sequence: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLE
DAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
Specifica
| Numero di accesso | AAH32130 |
| Da utilizzare con (applicazione) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulazione | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| ID gene (immissione) | 432 |
| Peso molecolare | 58.1 |
| Nome | ASGR1 (Human) Recombinant Protein (P01) |
| Intervallo di pH | 8 |
| Metodo di preparazione | In vitro wheat germ expression system |
| Metodo di purificazione | Glutathione Sepharose 4 Fast Flow |
| Analisi di controllo qualità | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Vedi altri risultati |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto