missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ASGR1 Recombinant Protein
Human full-length ORF recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00000432-P01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Encoded by ASGR1 gene with asialoglycoprotein receptor 1
- Preparation method:in vitro wheat germ expression system
- Molecular weight: 57.75kDa
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in the elution buffer
Sequence: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLE
DAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
AAH32130 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
58.1 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ASGR1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
432 | |
ASGR1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
HL-1/ASGPR/ASGPR1/CLEC4H1 | |
ASGR1 | |
Wheat Germ (in vitro) | |
GST |