missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ATP5I (Human) Recombinant Protein

Human ATP5I full-length ORF ( AAH03679, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000521-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16132061

  • 335.00€ / 10µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

  • Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Specifica

Specifica

AAH03679
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATP5I
GST
521
Wheat germ expression system
10 μg
ATP5K, MGC12532
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali