missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aurora B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
363.00€ - 547.00€
Specifica
| Antigene | Aurora B |
|---|---|
| Applicazioni | Immunocytochemistry, Immunofluorescence |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Specie ospite | Rabbit |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18236502
|
Novus Biologicals
NBP2-55144 |
100 μL |
547.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18683038
|
Novus Biologicals
NBP2-55144-25ul |
25 μL |
363.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
Aurora B Polyclonal specifically detects Aurora B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifica
| Aurora B | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, DNA Repair, Mitotic Regulators, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9212 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AIK2EC 2.7.11.1, AIM1Aik2, AIM-1STK-1, ARK2ARK-2, AurB, aurkb-sv2, Aurora- and IPL1-like midbody-associated protein 1, aurora kinase BSerine/threonine-protein kinase aurora-B, aurora kinase B-Sv1, aurora kinase B-Sv2, Aurora/IPL1-related kinase 2, aurora-1, aurora-B, Aurora-related kinase 2, EC 2.7.11, IPL1, serine/threonine kinase 12, serine/threonine-protein kinase 12, STK12aurkb-sv1, STK5 | |
| AURKB | |
| IgG | |
| Affinity Purified |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto