missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ B2M (Human) Recombinant Protein

Abnova™ B2M (Human) Recombinant Protein

Codice prodotto. 16132121
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16132121

Brand: Abnova™ H00000567P01.25ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

This item is not returnable. View return policy

Description

Human B2M full-length ORF ( AAH32589, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Specifications

Numero di accesso AAH32589
ID gene (immissione) 567
Nome beta-2-microglobulin
Metodo di preparazione Wheat germ expression system
Analisi di controllo qualità 125% SDS-PAGE Stained with Coomassie Blue
Quantità 25 μg
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Simbolo del gene B2M
Specie Wheat Germ (in vitro)
Tag proteine GST
Tampone 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.