missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B7-H4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Marca: Novus Biologicals NBP2-30536
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
B7-H4 Polyclonal specifically detects B7-H4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifica
| B7-H4 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q7Z7D3 | |
| VTCN1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL | |
| 0.1 mL | |
| Cancer, Cell Cycle and Replication | |
| 79679 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| B7h.5, B7-H4, B7H4T-cell costimulatory molecule B7x, B7S1VCTN1, B7XPRO1291, FLJ22418, Immune costimulatory protein B7-H4, Protein B7S1, T cell costimulatory molecule B7x, V-set domain containing T cell activation inhibitor 1, V-set domain-containing T-cell activation inhibitor 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto