missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ BPTF/FALZ Recombinant Protein Antigen
Sfoglia Tutto Bio Techne Prodotti
Click to view available options
Quantità:
100 μL
Dimensione della confezione:
100µL
Descrizione
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BPTF/FALZ. Source: E.coli Amino Acid Sequence: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ The BPTF/FALZ Recombinant Protein Antigen is derived from E. coli. The BPTF/FALZ Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifica
Specifica
| Gene ID (Entrez) | 2186 |
| Metodo di purificazione | >80% by SDS-PAGE and Coomassie blue staining |
| Nome comune | BPTF/FALZ Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles |
| Formulazione | PBS and 1M Urea, pH 7.4 |
| Da utilizzare con (applicazione) | Blocking/Neutralizing, Control |
| Alias gene | bromodomain and PHD domain transcription factor, Bromodomain and PHD finger-containing transcription factor, bromodomain PHD finger transcription factor, EC 3.6.1, EC 6.2.1.5, FAC1fetal Alz-50 reactive clone 1, FALZnucleosome-remodeling factor subunit BPT |
| Simbolo del gene | BPTF |
| Tipo di etichetta | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Vedi altri risultati |
For research use only.
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto