missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18386210

Novus Biologicals™ C-Reactive Protein/CRP Recombinant Protein Antigen

Codice prodotto. 18386210 Sfoglia Tutto Bio Techne Prodotti
missing translation for 'orderingAttributeHoverText'
Quantità:
0.1 mL
missing translation for 'unitSize'
0.10mL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18386210

missing translation for 'mfr': Novus Biologicals™ NBP187183PEP

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRP. The C-Reactive Protein/CRP Recombinant Protein Antigen is derived from E. coli. The C-Reactive Protein/CRP Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87183. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 1401
Specie Human
Metodo di purificazione Chromatography
Purezza >80%
Concentrazione 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulazione PBS and 1M Urea, pH 7.4.
Da utilizzare con (applicazione) Blocking/Neutralizing, Control
Simbolo del gene CRP
Tipo di etichetta Unlabeled
Peso molecolare 25kDa
Product Type C-Reactive Protein/CRP
Quantità 0.1 mL
Status giuridico RUO
Sorgente E.Coli
Reattività specifica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87183. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogeno VRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNW
Mehr anzeigen Weniger anzeigen

For Research Use Only

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt