Abnova™ CAPNS2 Recombinant Protein

Marca: Abnova™ H00084290-P01.10ug

Codice prodotto. 16125793

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Numero di accesso	AAH05397
Formulazione	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecolare	53.02
Intervallo di pH	8
Metodo di purificazione	Glutathione Sepharose 4 Fast Flow
Quantità	10 ug
Immunogeno	MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS
Alias gene	MGC12536/MGC14804
Simbolo del gene	CAPNS2
Specie	Wheat Germ (in vitro)
Tag proteine	GST

Da utilizzare con (applicazione)	Antibody Production, Protein Array, ELISA, Western Blot
ID gene (immissione)	84290
Nome	CAPNS2 (Human) Recombinant Protein (P01)
Metodo di preparazione	In vitro wheat germ expression system
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Sorgente	Wheat Germ (in vitro)
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nome comune	CAPNS2
Cross-reattività	Human
Recombinant	Recombinant
Forma	Solution

Suggerimenti di prodotto

Descrizione