missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD37 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-33969-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
CD37 Polyclonal specifically detects CD37 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| CD37 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P11049 | |
| CD37 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN | |
| 25 μL | |
| Cellular Markers, Immunology | |
| 951 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD37 antigentetraspanin-26, CD37 molecule, cell differentiation antigen 37, GP52-40, leukocyte antigen CD37, MGC120234, Tetraspanin-26, Tspan-26, TSPAN26leukocyte surface antigen CD37 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto