missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CDKN2C Recombinant Protein

Codice prodotto. 16123071
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 16123071

Marca: Abnova™ H00001031P01.10ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Numero di accesso AAH16173
Da utilizzare con (applicazione) Antibody Production, Protein Array, ELISA, Western Blot
Formulazione 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID gene (immissione) 1031
Peso molecolare 44.6
Nome CDKN2C (Human) Recombinant Protein (P01)
Intervallo di pH 8
Metodo di preparazione In vitro wheat germ expression system
Metodo di purificazione Glutathione Sepharose 4 Fast Flow
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 10 μg
Sorgente Wheat Germ (in vitro)
Immunogeno MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHMASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene INK4C/p18/p18-INK4C
Nome comune CDKN2C
Simbolo del gene CDKN2C
Cross-reattività Human
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Forma Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.