missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHIP/STUB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-47510-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
CHIP/STUB1 Polyclonal specifically detects CHIP/STUB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| CHIP/STUB1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Antigen NY-CO-7, Carboxy terminus of Hsp70-interacting protein, CHIPSTIP1 homology and U box-containing protein 1, CLL-associated antigen KW-8, E3 ubiquitin-protein ligase CHIP, EC 6.3.2.-, heat shock protein A binding protein 2 (c-terminal), HSPABP2, NY-CO-7, SDCCAG7, serologically defined colon cancer antigen 7, STIP1 homology and U-box containing protein 1, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, UBOX1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| STUB1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY | |
| 25 μL | |
| Neuroscience | |
| 10273 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto