missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CHP Recombinant Protein

Marca:  Abnova™ H00011261-P01.25ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16126462

  • 508.00€ / 25µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH08373
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
33.4
8
Glutathione Sepharose 4 Fast Flow
25 ug
MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS
SLC9A1BP
CHP
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
11261
CHP (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CHP
Human
Recombinant
Solution
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali