missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descrizione
DNA2 Polyclonal specifically detects DNA2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifica
Specifica
| Antigene | DNA2 |
| Applicazioni | Immunocytochemistry, Immunofluorescence |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Diluizione | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulazione | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias gene | DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297 |
| Simboli geni | DNA2 |
| Specie ospite | Rabbit |
| Immunogeno | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ |
| Vedi altri risultati |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?