missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMC7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
520.00€ - 647.00€
Specifica
| Antigene | EMC7 |
|---|---|
| Diluizione | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applicazioni | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18415161
|
Novus Biologicals
NBP1-88547-25ul |
25 μL |
520.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18255916
|
Novus Biologicals
NBP1-88547 |
0.1 mL |
647.00€
0.10mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
EMC7 Polyclonal specifically detects EMC7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifica
| EMC7 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 56851 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C11orf3, C15orf24, chromosome 15 hypothetical ATG/GTP binding protein, chromosome 15 open reading frame 24, ER membrane protein complex subunit 7, HT022, ORF1-FL1 | |
| EMC7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto