missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ER Membrane Protein Complex Subunit 10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-30611-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
ER Membrane Protein Complex Subunit 10 Polyclonal specifically detects ER Membrane Protein Complex Subunit 10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| ER Membrane Protein Complex Subunit 10 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q5UCC4 | |
| EMC10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C19orf63, Chromosome 19 Open Reading Frame 63, EMC10, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing 1, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing Protein 1, Hematopoietic Signal Peptide-Containing Secreted 1, HSM1, HSS1, INM02, UPF0510 Protein INM02 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 284361 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto