missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ ER Membrane Protein Complex Subunit 10 Recombinant Protein Antigen

Codice prodotto. 18150184 Sfoglia Tutto Bio Techne Prodotti
Click to view available options
Quantità:
0.1 mL
Dimensione della confezione:
0.10mL
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 18150184

Marca: Novus Biologicals™ NBP230611PEP

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EMC10. The ER Membrane Protein Complex Subunit 10 Recombinant Protein Antigen is derived from E. coli. The ER Membrane Protein Complex Subunit 10 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-30611. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 284361
Specie Human
Metodo di purificazione Chromatography
Purezza >80%
Concentrazione 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulazione PBS and 1M Urea, pH 7.4.
Da utilizzare con (applicazione) Blocking/Neutralizing, Control
Simbolo del gene EMC10
Tipo di etichetta Unlabeled
Peso molecolare 25kDa
Product Type ER Membrane Protein Complex Subunit 10
Quantità 0.1 mL
Status giuridico RUO
Sorgente E.Coli
Reattività specifica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30611. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogeno DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN
Show More Show Less

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.