missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EXOSC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-57209
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
EXOSC3 Polyclonal specifically detects EXOSC3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| EXOSC3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| bA3J10.7, CGI-102, exosome complex exonuclease RRP40, exosome component 3MGC15120, exosome component Rrp40, hRrp-40, hRrp40p, p10Rrp40p, Ribosomal RNA-processing protein 40, RP11-3J10.8, RRP40MGC723 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Xenopus: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q9NQT5 | |
| EXOSC3 | |
| Synthetic peptides corresponding to EXOSC3 (exosome component 3) The peptide sequence was selected from the middle region of EXOSC3. Peptide sequence TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK. | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 51010 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto