missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ FAXC Recombinant Protein Antigen

Codice prodotto. 18333510 Sfoglia Tutto Bio Techne Prodotti
Click to view available options
Quantità:
0.1 mL
Dimensione della confezione:
0.10mL
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 18333510

Marca: Novus Biologicals™ NBP190579PEP

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAXC. The FAXC Recombinant Protein Antigen is derived from E. coli. The FAXC Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-90579. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 84553
Specie Human
Metodo di purificazione Chromatography
Purezza >80%
Concentrazione 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulazione PBS and 1M Urea, pH 7.4.
Da utilizzare con (applicazione) Blocking/Neutralizing, Control
Simbolo del gene FAXC
Tipo di etichetta Unlabeled
Peso molecolare 27kDa
Product Type C6orf168
Quantità 0.1 mL
Status giuridico RUO
Sorgente E.Coli
Reattività specifica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90579. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogeno HFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLG
Mostrar más Mostrar menos

For Research Use Only

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado