missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FBXO45 (Human) Recombinant Protein
Human FBXO45 partial ORF ( XP_117294.3, 39 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00200933-Q01.10ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
- Sequence: LPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKI
Specifica
| XP_117294.3 | |
| F-box protein 45 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FBXO45 | |
| GST |
| 200933 | |
| Wheat germ expression system | |
| 10 μg | |
| Fbx45 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |