missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FBXO45 (Human) Recombinant Protein

Human FBXO45 partial ORF ( XP_117294.3, 39 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00200933-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16132397

  • 335.00€ / 10µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

  • Sequence: LPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKI
Specifica

Specifica

XP_117294.3
F-box protein 45
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FBXO45
GST
200933
Wheat germ expression system
10 μg
Fbx45
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali