missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ FCN3 Recombinant Protein

Abnova™ FCN3 Recombinant Protein

Codice prodotto. 16132562
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 16132562

Marca: Abnova™ H00008547P01.25ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Numero di accesso AAH20731
Da utilizzare con (applicazione) Antibody Production, Protein Array, ELISA, Western Blot
Formulazione 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID gene (immissione) 8547
Peso molecolare 57.42
Nome FCN3 (Human) Recombinant Protein (P01)
Intervallo di pH 8
Metodo di preparazione In vitro wheat germ expression system
Metodo di purificazione Glutathione Sepharose 4 Fast Flow
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 25 μg
Sorgente Wheat Germ (in vitro)
Immunogeno MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene FCNH/HAKA1/MGC22543
Nome comune FCN3
Simbolo del gene FCN3
Cross-reattività Human
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Forma Solution
Vedi altri risultati Mostra meno risultati
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado