missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FXR1 (Human) Recombinant Protein
Human FXR1 partial ORF ( AAH28983, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00008087-Q01.10ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
- Sequence: VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFH
Specifica
| AAH28983 | |
| fragile X mental retardation, autosomal homolog 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 8087 | |
| Wheat germ expression system | |
| 10 μg | |
| FXR1 | |
| GST |