missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCAT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
583.00€ - 890.00€
Specifica
| Antigene | GCAT |
|---|---|
| Diluizione | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applicazioni | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18374715
|
Novus Biologicals
NBP3-17854-25UL |
25 μg |
583.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18315192
|
Novus Biologicals
NBP3-17854-100UL |
100 μg |
890.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
GCAT Polyclonal antibody specifically detects GCAT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifica
| GCAT | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 23464 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 2-amino-3-ketobutyrate-CoA ligase, AKB ligase, Aminoacetone synthase, EC 2.3.1, EC 2.3.1.29, Glycine acetyltransferase, glycine C-acetyltransferase, glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase), KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial, MGC23053 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RGAGTWKSERVITSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto