missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glut2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-48586-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Glut2 Polyclonal antibody specifically detects Glut2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifica
| Glut2 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| GLUT-2, GLUT2 Glucose transporter type 2, liver, SLC2A2, solute carrier family 2 (facilitated glucose transporter), member 2, solute carrier family 2, facilitated glucose transporter member 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATET | |
| 25 μL | |
| Lipid and Metabolism, Stem Cell Signaling Pathway | |
| 6514 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto