missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutathione S-Transferase pi 1/GSTP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-84747
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Glutathione S-Transferase pi 1/GSTP1 Polyclonal antibody specifically detects Glutathione S-Transferase pi 1/GSTP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifica
| Glutathione S-Transferase pi 1/GSTP1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
| deafness, X-linked 7, EC 2.5.1.18, FAEES3, fatty acid ethyl ester synthase III, glutathione S-transferase P, glutathione S-transferase pi 1, GST class-pi, GST3DFN7, GSTP, GSTP1-1, PI | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLS | |
| 0.1 mL | |
| Asthma, Cancer, Immunology | |
| 2950 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto