missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GMPS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
559.00€
Specifica
| Antigene | GMPS |
|---|---|
| Applicazioni | Western Blot |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Specie ospite | Rabbit |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18292375
|
Novus Biologicals
NBP1-52972 |
100 μL |
559.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.Specifica
| GMPS | |
| Polyclonal | |
| Rabbit | |
| P49915 | |
| 8833 | |
| Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein | |
| GMPS | |
| IgG | |
| 77 kDa |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto