Learn More
Abnova™ HDAC8 Recombinant Protein
Descrizione
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA.
- Human HDAC8 full-length ORF ( AAH50433, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal
- histone deacetylase 8
- Theoretical molecular weight: 66.99kDa
- Preparation: in vitrowheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSPAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDG VEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Specifica
Specifica
| Numero di accesso | AAH50433 |
| Da utilizzare con (applicazione) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulazione | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| ID gene (immissione) | 55869 |
| Peso molecolare | 66.99 |
| Nome | HDAC8 (Human) Recombinant Protein (P01) |
| Intervallo di pH | 8 |
| Metodo di preparazione | In vitro wheat germ expression system |
| Metodo di purificazione | Glutathione Sepharose 4 Fast Flow |
| Analisi di controllo qualità | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Vedi altri risultati |
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.