missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HDAC8 Recombinant Protein

Codice prodotto. p-3719379
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 16171913

Marca: Abnova™ H00055869P01.10ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Recombinant protein for HDAC8 (human) gene

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA.

  • Human HDAC8 full-length ORF ( AAH50433, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal
  • histone deacetylase 8
  • Theoretical molecular weight: 66.99kDa
  • Preparation: in vitrowheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSPAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDG VEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Specifica

Numero di accesso AAH50433
Da utilizzare con (applicazione) Antibody Production, Protein Array, ELISA, Western Blot
Formulazione 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID gene (immissione) 55869
Peso molecolare 66.99
Nome HDAC8 (Human) Recombinant Protein (P01)
Intervallo di pH 8
Metodo di preparazione In vitro wheat germ expression system
Metodo di purificazione Glutathione Sepharose 4 Fast Flow
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 10 μg
Sorgente Wheat Germ (in vitro)
Immunogeno MEEPEEPADSGQSLVPVYIYSPEYVSMCDSPAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene HDACL1/RPD3
Nome comune HDAC8
Simbolo del gene HDAC8
Cross-reattività Human
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Forma Solution
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato