missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LASS1 Partial ORF (NP_067090.1, 301 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010715-Q01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16133056

  • 335.00€ / 10µg
Spedizione stimata: 26-07-2024
per visualizzare lo stock disponibile

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!


Descrizione

Descrizione

This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site that is cleaved to produce a mature protein containing seven conserved cysteine residues. Members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in yeast suggest that the encoded protein is involved in aging. This protein is transcribed from a monocistronic mRNA as well as a bicistronic mRNA, which also encodes growth differentiation factor 1. [provided by RefSeq]

Sequence: YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Specifica

Specifica

NP_067090.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.24kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
RUO
LASS1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
10715
LASS1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CerS1/LAG1/MGC90349/UOG1
LASS1
Recombinant
wheat germ expression system
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali