missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HUNK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-14111-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
HUNK Polyclonal specifically detects HUNK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| HUNK | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| B19, EC 2.7.11, EC 2.7.11.1, hormonally up-regulated neu tumor-associated kinase, hormonally upregulated neu tumor-associated kinase, hormonally up-regulated Neu-associated kinase, hormonally upregulated Neu-associated kinase, MAKV, serine/threonine protein kinase MAK-V, Serine/threonine-protein kinase MAK-V | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HUNK | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG | |
| 25ul | |
| Cancer, GPCR, Protein Kinase | |
| 30811 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto