missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ IL1B (Human) Recombinant Protein (P01)

Codice prodotto. p-7184947
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 16136731

Marca: Abnova™ H00003553P01.10ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Human IL1B full-length ORF ( AAH08678, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal

Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

bullets1 (begin)Molecular weight: 50.33kDa
Preparation method:italics (begin) in vitroitalics (end) wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Quality Control Testing:12.5% SDS-PAGE stained with Coomassie Bluebullets1 (end)

Best use within three months from the date of receipt of this protein

Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array

Specifica

Numero di accesso AAH08678
Da utilizzare con (applicazione) Antibody Production, Protein Array, ELISA, Western Blot
ID gene (immissione) 3553
Nome IL1B (Human) Recombinant Protein (P01)
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 10 μg
Sorgente Wheat Germ (in vitro)
Immunogeno MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene IL-1/IL1-BETA/IL1F2
Nome comune IL1B
Simbolo del gene IL1B
Specie Wheat Germ (in vitro)
Tag proteine GST
Vedi altri risultati Mostra meno risultati

For Research Use Only

Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato