missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MED9 Antibody, R&D Systems™

MED9 Antibody, R&D Systems™

Código de producto. 18120484 Tienda Bio Techne Productos
Cambiar vista
Click to view available options
Quantity:
25 μL
0.1 mL
Tamaño de la unidad:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity Tamaño de la unidad
18120484 0.1 mL 0.1mL
18457391 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18120484 Proveedor Novus Biologicals N.º de proveedor NBP231639
  • ONLINE EXCLUSIVE PRICE
    751.30€
    708.75€ / 0.1mL
    Risparmia 42.55€
    5% Sconto
 Restricted Item
Spedizione stimata: 02-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MED9 Polyclonal specifically detects MED9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).

TRUSTED_SUSTAINABILITY

Especificaciones

Antigen MED9
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9NWA0
Gene Alias FLJ10193mediator of RNA polymerase II transcription, subunit 9 homolog, MED25mediator of RNA polymerase II transcription subunit 9, mediator complex subunit 9MGC138234, mediator of RNA polymerase II transcription, subunit 9 homolog (S. cerevisiae), mediator subunit 25
Gene Symbols MED9
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55090
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.