missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18205593

Novus Biologicals™ MICB Recombinant Protein Antigen

Codice prodotto. 18205593 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
100 μL
Dimensione della confezione:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18205593 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18205593 Fornitore Novus Biologicals™ N. del fornitore NBP256506PEP

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MICB. Source: E.coli Amino Acid Sequence: CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE The MICB Recombinant Protein Antigen is derived from E. coli. The MICB Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 4277
Metodo di purificazione >80% by SDS-PAGE and Coomassie blue staining
Nome comune MICB Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulazione PBS and 1M Urea, pH 7.4.
Da utilizzare con (applicazione) Blocking/Neutralizing, Control
Alias gene MHC class I chain-related protein B, MHC class I mic-B antigen, MHC class I polypeptide-related sequence B, MIC-B, PERB11.2MHC class I-like molecule PERB11.2-IMX, stress inducible class I homolog
Simbolo del gene MICB
Tipo di etichetta Unlabeled
Product Type Recombinant Protein Antigen
Quantità 100 μL
Status giuridico RUO
Sorgente E.coli
Reattività specifica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52790. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vedi altri risultati Mostra meno risultati

Esclusivamente per scopi di ricerca.

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.