missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MRS2L Recombinant Protein

Marca:  Abnova™ H00057380-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16132643

  • 508.00€ / 25µg
Spedizione stimata: 26-08-2024
per visualizzare lo stock disponibile

Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH01028
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
38.61
8
Glutathione Sepharose 4 Fast Flow
25 ug
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS
HPT/MGC78523/MRS2L
MRS2
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
57380
MRS2L (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MRS2
Human
Recombinant
Solution
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Product Certifications
Ofertas especiales

Ofertas especiales