missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
242.00€ - 578.00€
Specifica
| Antigene | Muscarinic Acetylcholine Receptor M1/CHRM1 |
|---|---|
| Diluizione | Western Blot 1:500 - 1:2000 |
| Applicazioni | Western Blot |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18653252
|
Novus Biologicals
NBP2-93968-0.02ml |
0.02 mL |
242.00€
0.02mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18649051
|
Novus Biologicals
NBP2-93968-0.1ml |
0.1 mL |
578.00€
0.01mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
Muscarinic Acetylcholine Receptor M1/CHRM1 Polyclonal antibody specifically detects Muscarinic Acetylcholine Receptor M1/CHRM1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifica
| Muscarinic Acetylcholine Receptor M1/CHRM1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Transcription Factors and Regulators | |
| PBS (pH 7.3), 50% glycerol | |
| 1128 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| cholinergic receptor, muscarinic 1, HM1, M1, M1R, MGC30125, muscarinic acetylcholine receptor M1 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-460 of human Muscarinic Acetylcholine Receptor M1/CHRM1 (NP_000729.2). WELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title