missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ NCOA5 Recombinant Protein

Abnova™ NCOA5 Recombinant Protein

Codice prodotto. 16172953
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 16172953

Marca: Abnova™ H00057727P01.10ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Numero di accesso AAH56872
Da utilizzare con (applicazione) Antibody Production, Protein Array, ELISA, Western Blot
Formulazione 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID gene (immissione) 57727
Peso molecolare 60.39
Nome NCOA5 (Human) Recombinant Protein (P01)
Intervallo di pH 8
Metodo di preparazione In vitro wheat germ expression system
Metodo di purificazione Glutathione Sepharose 4 Fast Flow
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 10 μg
Sorgente Wheat Germ (in vitro)
Immunogeno MAGMPGTAETFETPETCGTTDMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGELRGRAEARFPANHSGRPRVPR
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene CIA/bA465L10.6
Nome comune NCOA5
Simbolo del gene NCOA5
Cross-reattività Human
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Forma Solution
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt