missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NRAS (Human) Recombinant Protein

Human NRAS full-length ORF ( NP_002515.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00004893-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16162075

  • 302.00€ / 10µg


Spedizione stimata
23-11-2020
Aggiungi al carrello

Descrizione

Descrizione

  • Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Specifica

Specifica

NP_002515.1
neuroblastoma RAS viral (v-ras) oncogene homolog
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NRAS
GST
4893
Wheat germ expression system
10 μg
ALPS4, N-ras, NRAS1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documenti