missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2Y12/P2RY12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 5 publications
351.00€ - 676.00€
Specifica
| Antigene | P2Y12/P2RY12 |
|---|---|
| Diluizione | Western Blot - reported in scientific literature (PMID:31968618)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence -validated from a verified customer review, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -validated from a verified customer review |
| Applicazioni | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18496111
|
Novus Biologicals
NBP2-33870-25ul |
25 μL |
351.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18785033
|
Novus Biologicals
NBP2-33870 |
0.1 mL |
676.00€
0.10mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
P2Y12/P2RY12 Polyclonal specifically detects P2Y12/P2RY12 in Human, Canine, Feline samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifica
| P2Y12/P2RY12 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| RUO | |
| Human, Feline | |
| Q9H244 | |
| 64805 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot - reported in scientific literature (PMID:31968618)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence -validated from a verified customer review, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -validated from a verified customer review | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADPG-R, Gi-coupled ADP receptor HORK3, HORK3P2Y12 platelet ADP receptor, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12ADP-glucose receptor, purinergic receptor P2RY12, purinergic receptor P2Y, G-protein coupled, 12, putative G-protein coupled receptor, SP1999G-protein coupled receptor SP1999 | |
| P2RY12 | |
| IgG | |
| Affinity Purified | |
| Specificity of human P2Y12/P2RY12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts