missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Pannexin-1 Antibody, Novus Biologicals™

Pannexin-1 Antibody, Novus Biologicals™

Codice prodotto. 18472271 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
Dimensione della confezione:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità unitSize
18472271 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18472271 Fornitore Novus Biologicals N. del fornitore NBP19224125ul

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

Pannexin-1 Polyclonal specifically detects Pannexin-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Specifica

Antigene Pannexin-1
Applicazioni Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias gene MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529
Simboli geni PANX1
Specie ospite Rabbit
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 24145
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.