missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PHGDH Recombinant Protein

Codice prodotto. 16128192
Click to view available options
Quantità:
10 μg
25 μg
Dimensione della confezione:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Product Code. 16128192

missing translation for 'mfr': Abnova™ H00026227P01.10ug

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

This item is not returnable. View return policy

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Numero di accesso AAH11262.1
Da utilizzare con (applicazione) Antibody Production, Protein Array, ELISA, Western Blot
Formulazione 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID gene (immissione) 26227
Peso molecolare 84.4
Nome PHGDH (Human) Recombinant Protein (P01)
Intervallo di pH 8
Metodo di preparazione In vitro wheat germ expression system
Metodo di purificazione Glutathione Sepharose 4 Fast Flow
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 10 μg
Sorgente Wheat Germ (in vitro)
Immunogeno MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene 3-PGDH/3PGDH/MGC3017/PDG/PGAD/PGD/PGDH/SERA
Nome comune PHGDH
Simbolo del gene PHGDH
Cross-reattività Human
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Forma Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.