missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PMP70 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 5 publications
Marca: Novus Biologicals NBP1-87258-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
PMP70 Polyclonal specifically detects PMP70 in Human, Mouse, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifica
| PMP70 | |
| Polyclonal | |
| Western Blot, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| 70 kDa peroxisomal membrane protein, ABC43, ATP-binding cassette, sub-family D (ALD), member 3, peroxisomal membrane protein 1 (70kD, Zellweger syndrome), Peroxisomal membrane protein-1 (70kD), PMP70ATP-binding cassette sub-family D member 3, PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)), ZWS2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human PMP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ABCD3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS | |
| 25 μL | |
| ABC Transporters, Cellular Markers, Lipid and Metabolism, Neuroscience, Peroxisome Markers, Signal Transduction | |
| 5825 | |
| Human, Mouse | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto