missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18154163

Novus Biologicals™ Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen

Codice prodotto. 18154163 Sfoglia Tutto Bio Techne Prodotti
Click to view available options
Quantità:
0.1mL
Dimensione della confezione:
0.10mL
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 18154163

Marca: Novus Biologicals™ NBP233585PEP

Effettua il per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKAR1A. The Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen is derived from E. coli. The Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-33585. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 5573
Specie Human
Metodo di purificazione Chromatography
Purezza >80%
Concentrazione 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulazione PBS and 1M Urea, pH 7.4.
Da utilizzare con (applicazione) Blocking/Neutralizing, Control
Simbolo del gene PRKAR1A
Tipo di etichetta Unlabeled
Peso molecolare 22kDa
Product Type Protein Kinase A regulatory subunit I alpha
Quantità 0.1mL
Status giuridico RUO
Sorgente E.Coli
Reattività specifica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33585. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogeno MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP
Vedi altri risultati Mostra meno risultati

For Research Use Only

Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato